Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin NIP1-2(NIP1-2)

Recombinant Arabidopsis thaliana Aquaporin NIP1-2(NIP1-2)

SKU:CSB-CF853929DOA

Regular price $2,303.00 CAD
Regular price Sale price $2,303.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8LFP7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEISGNGGDARDGAVVVNLKEEDEQQQQQQAIHKPLKKQDSLLSISVPFLQKLMAEVLG TYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFAS CGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVI EFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMV YSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSSR

Protein Names:Recommended name: Aquaporin NIP1-2 Alternative name(s): NOD26-like intrinsic protein 1-2 Short name= AtNIP1;2 Nodulin-26-like major intrinsic protein 2 Short name= NodLikeMip2 Short name= Protein NLM2

Gene Names:Name:NIP1-2 Synonyms:NLM2 Ordered Locus Names:At4g18910 ORF Names:F13C5.80

Expression Region:1-294

Sequence Info:full length protein

View full details