Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_477942 (ARALYDRAFT_477942)

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_477942 (ARALYDRAFT_477942)

SKU:CSB-CF520612DNZ

Regular price $2,164.40 CAD
Regular price Sale price $2,164.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7L5G6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASTENPDPETGKSEPIPASATTPPPSAASFLDCRKIDVIIRVLLFSATLTALIVMVTSD QTEKTQLPGVSSPAPVSAEFNDSPAFIFFVVALVVTSFYALMSTLVSISLLLKPEFTARV SVYLASLDMVMLGILASATGTAGGVAYIALKGNKEVGWNKICNVYDKFCRYIATSLALSL FATLLLLVLSICSALSKRTP

Protein Names:Recommended name: CASP-like protein ARALYDRAFT_477942

Gene Names:ORF Names:ARALYDRAFT_477942

Expression Region:1-200

Sequence Info:full length protein

View full details