Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_327471 (ARALYDRAFT_327471)

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_327471 (ARALYDRAFT_327471)

SKU:CSB-CF517148DNZ

Regular price $2,111.20 CAD
Regular price Sale price $2,111.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7M2M8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKLTKRIGGLVLRLAAFGAALAALIVMITSRERASFFAVSLEAKYTDMAAFKYFVIANA VVSVYSFLVLFLPKESLLWKFVVVLDLVMTMLLTSSLSAALAVAQVGKKGNANAGWLPIC GQVPKFCDQITGALIAGFVALVLYVLLLLYSLHSVVDPFLLQKS

Protein Names:Recommended name: CASP-like protein ARALYDRAFT_327471

Gene Names:ORF Names:ARALYDRAFT_327471

Expression Region:1-164

Sequence Info:full length protein

View full details