Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

SKU: CSB-YP342610DNL

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Allergen

Uniprot ID: P49372

Gene Names: N/A

Organism: Apium graveolens (Celery)

AA Sequence: MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Expression Region: 1-154aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 18.3 kDa

Alternative Name(s): Allergen Api g 1.0101 Allergen Api g I Allergen: Api g 1

Relevance:

Reference: "Crystal structure of the major celery allergen Api g 1: molecular analysis of cross-reactivity."Schirmer T., Hoffimann-Sommergrube K., Susani M., Breiteneder H., Markovic-Housley Z.J. Mol. Biol. 351:1101-1109(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.