Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2

CSB-YP310896DNL
Regular price
$1,263.14 CAD
Sale price
$1,263.14 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P92918

Gene Names: N/A

Organism: Apium graveolens (Celery)

AA Sequence: MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Expression Region: 1-159aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 19.1 kDa

Alternative Name(s):

Relevance:

Reference: Characterization of Api g 1.0201, a new member of the Api g 1 family of Celery Allergens.Hoffmann-Sommergruber K., Ferris R., Pec M., Radauer G., O'Riordain G., Camara-Machado O., Scheiner O., Breiteneder H.Int. Arch. Allergy Immunol. 122:115-123(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share