Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1

SKU: CSB-EP2019DNL

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: P49372

Gene Names: N/A

Organism: Apium graveolens (Celery)

AA Sequence: MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Expression Region: 1-154aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.3 kDa

Alternative Name(s): Allergen Api g 1.0101 Allergen Api g I Allergen: Api g 1

Relevance:

Reference: "Molecular characterization of Api g 1, the major allergen of celery (Apium graveolens), and its immunological and structural relationships to a group of 17-KDA tree pollen allergens."Breiteneder H., Hoffmann-Sommergruber K., O'Riordain G., Susani M., Ahorn H., Ebner C., Kraft D., Scheiner O.Eur. J. Biochem. 233:484-489(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.