Recombinant Anopheles gambiae  UPF0443 protein AGAP003534(AGAP003534)

Recombinant Anopheles gambiae UPF0443 protein AGAP003534(AGAP003534)

CSB-CF745738BZL
Regular price
$1,398.00 CAD
Sale price
$1,398.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anopheles gambiae (African malaria mosquito)

Uniprot NO.:Q7PH91

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKLRGGQTKETRKQRQERKEENLKIQQQMKTIVLPTIGVIFLCIVVYVFLKTRPRYEEL

Protein Names:Recommended name: UPF0443 protein AGAP003534

Gene Names:ORF Names:AGAP003534

Expression Region:1-60

Sequence Info:full length protein

Your list is ready to share