Gene Bio Systems
Recombinant Anopheles gambiae Transmembrane protein 234 homolog (AGAP012180)
Recombinant Anopheles gambiae Transmembrane protein 234 homolog (AGAP012180)
SKU:CSB-CF369405BZL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Anopheles gambiae (African malaria mosquito)
Uniprot NO.:A0NGI1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDSPENTVPASVDIYAVLSILLVAIMWGATNPFIKRGSIGYNELKADSKLGQLWLEVRFL ITRWQYLLPLVINQLGSIVYVLTLQRTELSLTVPMANSLTFVFTAITARLLGERQSGWKI YCGMTLVILGTVICGLDKML
Protein Names:Recommended name: Transmembrane protein 234 homolog
Gene Names:ORF Names:AGAP012180
Expression Region:1-140
Sequence Info:full length protein
