Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anaerobic C4-dicarboxylate transporter DcuA(dcuA)

Recombinant Anaerobic C4-dicarboxylate transporter DcuA(dcuA)

SKU:CSB-CF328158SYN

Regular price $2,063.60 CAD
Regular price Sale price $2,063.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Serratia marcescens

Uniprot NO.:P40684

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLAVELVIVLLAIFLGARLGGIGIGFAGGLGVLALALIGVKPGNIPFDVISIIMAVIAAI SAMQVAGGMDYLVQQTEKLLRKNPKHITILAPIVTYFLTIFAGTGNISLSALPVIAEVAK EQGIKPCRPLST

Protein Names:Recommended name: Anaerobic C4-dicarboxylate transporter DcuA

Gene Names:Name:dcuA

Expression Region:1-132

Sequence Info:full length protein

View full details