Gene Bio Systems
Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK(psaK)
Recombinant Anabaena variabilis Photosystem I reaction center subunit PsaK(psaK)
SKU:CSB-CF334968BYN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Uniprot NO.:P23317
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AATTPLEWSPTIGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGIILGLHNLGRF
Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.8 kDa polypeptide Photosystem I subunit X
Gene Names:Name:psaK Ordered Locus Names:Ava_2445
Expression Region:9-86
Sequence Info:full length protein
