Gene Bio Systems
Recombinant Amphidinium carterae Caroteno-chlorophyll a-c-binding protein
Recombinant Amphidinium carterae Caroteno-chlorophyll a-c-binding protein
SKU:CSB-CF347637AJA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Amphidinium carterae (Dinoflagellate)
Uniprot NO.:P55738
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:XFENERGVADPVGFFDPLGFTADGSVENFKKLAQTEIKHGRVAMLATMGYITQEITGKLP GYLSPSTGVKYDDDINGVLGLIKIVPAGLWGIMIFYAALSLA
Protein Names:Recommended name: Caroteno-chlorophyll a-c-binding protein
Gene Names:
Expression Region:1-102
Sequence Info:full length protein
