Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ambrosia artemisiifolia Pectate lyase 1

Recombinant Ambrosia artemisiifolia Pectate lyase 1

SKU:CSB-EP326746BYC

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: P27760

Gene Names: N/A

Organism: Ambrosia artemisiifolia (Short ragweed)

AA Sequence: AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC

Expression Region: 26-398aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 44.8 kDa

Alternative Name(s): Antigen Amb a I Antigen E Short name:AgE

Relevance: Has pectate lyase activity.

Reference: "Isolation and characterization of a new basic antigen from short ragweed pollen (Ambrosia artemisiifolia)."Pilyavskaya A., Wieczorek M., Jones S.W., Gross K.Mol. Immunol. 32:523-529(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details