Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P79085
Gene Names: ALTA1
Organism: Alternaria alternata (Alternaria rot fungus) (Torula alternata)
AA Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
Expression Region: 19-157aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17.2 kDa
Alternative Name(s): Allergen: Alt a 1
Relevance:
Reference: Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit.De Vouge M.W., Thaker A.J., Curran I.H., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 111:385-395(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.