Recombinant Alnus glutinosa Major pollen allergen Aln g 1

SKU: CSB-YP334499AZS

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Allergen

Uniprot ID: P38948

Gene Names: N/A

Organism: European alder

AA Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN

Expression Region: 2-160aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 19.2 kDa

Alternative Name(s): Allergen Aln g I Allergen: Aln g 1

Relevance:

Reference: "Complementary DNA cloning and expression in Escherichia coli of Aln g I, the major allergen in pollen of alder (Alnus glutinosa)." Breiteneder H., Ferreira F., Reikerstorfer A., Duchene M., Valenta R., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Kraft D., Scheiner O.J. Allergy Clin. Immunol. 90:909-917(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.