GeneBio Systems
Recombinant Allium sativum Mannose-specific lectin (LECASAL)
Recombinant Allium sativum Mannose-specific lectin (LECASAL)
SKU:P83886
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P83886
Gene Names: LECASAL
Alternative Name(s): ASAL;ASARI;Allimin;Leaf agglutinin;Root agglutinin
Abbreviation: Recombinant Allium sativum LECASAL protein
Organism: Allium sativum (Garlic)
Source: E.coli
Expression Region: 31-181aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: RNVLTNGEGLYAGQSLDVEQYKFIMQDDCNLVLYEYSTPIWASNTGVTGKNGCRAVMQRDGNFVVYDVNGRPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWSTGTYRRSVGGAVVMAMNGTVDGGSVIGPVVVNQNVTAAIRKVGTGAA
MW: 23.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Mannose-specific lectin. Shows agglutinating activity towards rabbit erythrocytes. However, it does not show agglutinating activity towards human erythrocytes. Has insecticidal activity against the cotton leafworm S.littoralis and the peach potato aphid M.persicae. Also displays antiviral activity and therefore may contribute to defense against infections.
Reference:
Function:
