Gene Bio Systems
Recombinant Alkaliphilus oremlandii UPF0316 protein Clos_0555 (Clos_0555)
Recombinant Alkaliphilus oremlandii UPF0316 protein Clos_0555 (Clos_0555)
SKU:CSB-CF427921AUQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs))
Uniprot NO.:A8MLK3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEALLGYLLIFVARLTDVSMATIRMIMVVKGKRVIAACIGFVEVSIYVVAIGKVLSGMDN PLNVLAYASGFATGNYVGIFLEEKMALGNIIAQVISDYEVEKLVEKLRNVGFGVTVIEGY GREGIRYILNVSLQRKHLSRLYQTVEEHDKKAFVTVTDARAIRGGYFAGMKK
Protein Names:Recommended name: UPF0316 protein Clos_0555
Gene Names:Ordered Locus Names:Clos_0555
Expression Region:1-172
Sequence Info:full length protein
