Gene Bio Systems
Recombinant Ajellomyces capsulata Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Recombinant Ajellomyces capsulata Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
SKU:CSB-CF513825AZA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ajellomyces capsulata (strain H143) (Darling's disease fungus) (Histoplasma capsulatum)
Uniprot NO.:C6H220
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNTPLPSSFDAHPEFFQETKWQKFTRRIKEEPLIPIGYAATSYALWRAYKSMKAGDSVE LNRMFRARIYGHAFTLFAIVAGGIYYGQERRQRKEFEKALQQKQDQEKRDAWLKELEIRD KEDKDWRQRHAAIEMAAKEAEKKRG
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 ORF Names:HCDG_00752
Expression Region:1-145
Sequence Info:full length protein
