Gene Bio Systems
Recombinant Agrobacterium tumefaciens Uncharacterized protein Atu2659.1(Atu2659.1)
Recombinant Agrobacterium tumefaciens Uncharacterized protein Atu2659.1(Atu2659.1)
SKU:CSB-CF844906AYS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)
Uniprot NO.:Q8U530
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSCNQDTEILMLALFQTIDLALNLYTWVLIASAIFSWLYAFNVINSRNQFVNAIGSFLVN VTEPALRPIRRILPNLGGIDISPIILLLIIFFIRSFMWNTLYPMTV
Protein Names:Recommended name: Uncharacterized protein Atu2659.1
Gene Names:Ordered Locus Names:Atu2659.1 ORF Names:AGR_C_4820
Expression Region:1-106
Sequence Info:full length protein
