Gene Bio Systems
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin
Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin
SKU:CSB-EP307045AET
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P82981
Gene Names:N/A
Organism:Agkistrodon contortrix contortrix (Southern copperhead)
AA Sequence:VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
Expression Region:1-234aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:32.4 kDa
Alternative Name(s):Fibrinogen-clotting enzyme (Snake venom serine protease) (SVSP) (Venombin B)
Relevance:Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1).
Reference:"A novel venombin B from Agkistrodon contortrix contortrix: evidence for recognition properties in the surface around the primary specificity pocket different from thrombin." Amiconi G., Amoresano A., Boumis G., Brancaccio A., De Cristofaro R., De Pascalis A., Di Girolamo S., Maras B., Scaloni A. Biochemistry 39:10294-10308(2000)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1).
Involvement in disease:
Subcellular Location:Secreted
Protein Families:Peptidase S1 family, Snake venom subfamily
Tissue Specificity:Expressed by the venom gland.
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
