Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Uncharacterized protein F165R (War-056)

Recombinant African swine fever virus Uncharacterized protein F165R (War-056)

SKU:CSB-CF316390AEI

Regular price $2,112.60 CAD
Regular price Sale price $2,112.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)

Uniprot NO.:P0CA69

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANPNKRIMNKKSKQASISSILNFFFFYIMEYFVAVDNETSLGVFTSIEQCEETMKQYPG LHYVVFKYTCPADAENTDVVYLIPSLTLHTPMFVDHCPNRTKQARHVLKKINLVFEEESI ENWKVSVNTVFPHVHNRLSAPKLSIDEANEAVEKFLIQAGRLMSL

Protein Names:Recommended name: Uncharacterized protein F165R Short name= pF165R

Gene Names:Ordered Locus Names:War-056

Expression Region:1-165

Sequence Info:full length protein

View full details