Recombinant African swine fever virus  Uncharacterized protein A118R(Ba71V-035)

Recombinant African swine fever virus Uncharacterized protein A118R(Ba71V-035)

CSB-CF720760AEJ
Regular price
$1,460.00 CAD
Sale price
$1,460.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Uniprot NO.:Q65139

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHSNAFFNLIACVLFPTPLIPSMVISIPRMINKWVKRVQFLTFLTNLFLYNIVQHYINRI RCYSFIKYLLLYNLYRPIFGRSLQMAITKIKIISDATAAVLLKSCAAMYDVLIDKKFK

Protein Names:Recommended name: Uncharacterized protein A118R

Gene Names:Ordered Locus Names:Ba71V-035 ORF Names:A118R

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share