Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Protein H108R (Pret-129)

Recombinant African swine fever virus Protein H108R (Pret-129)

SKU:CSB-CF315478AYG

Regular price $1,811.25 CAD
Regular price Sale price $1,811.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)

Uniprot NO.:P0CA14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNLFPVFTLIVIITILITTRELSTTMLIVSLVTDYIIINTQYTEQQHENNTFSMPQKNS FSESYNKDKKSNTHIPYQWLAPELKEAESKYWWGNYDPHSEPVLAGAS

Protein Names:Recommended name: Protein H108R Short name= pH108R

Gene Names:Ordered Locus Names:Pret-129

Expression Region:1-108

Sequence Info:full length protein

View full details