Recombinant African swine fever virus  Major structural protein p17(Mal-115)

Recombinant African swine fever virus Major structural protein p17(Mal-115)

CSB-CF727435AYE
Regular price
$1,458.00 CAD
Sale price
$1,458.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Uniprot NO.:Q65223

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTETSPLLSHNLSTREGIKQNTQGLLAHTIARHPGITAIILGILILLVIILIIVAIVYY NRSVDCKSNMPRPPPSYSIQQSEPHHHFPVFFRKRKNSTSQQAHIPSDEQLAELVHS

Protein Names:Recommended name: Major structural protein p17

Gene Names:Ordered Locus Names:Mal-115 ORF Names:i1L

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share