Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aeropyrum pernix UPF0290 protein APE_0433(APE_0433)

Recombinant Aeropyrum pernix UPF0290 protein APE_0433(APE_0433)

SKU:CSB-CF896629AYB

Regular price $2,126.60 CAD
Regular price Sale price $2,126.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)

Uniprot NO.:Q9YF05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALELAVDWRIDNILEAIILMLPAMIANATPVVAGGRRPVDMGVVLPDGRRLLGDGKTIE GLLAGFAAGSAAGVLAALASGNMLLAVHSPAIALGALAGDMAGSFVKRRLGIERGRPAPL LDQLDFYLGALAVSIALGYTWTPRVAVEAAAAVLLLHLAANITAYLLGLKKVPW

Protein Names:Recommended name: UPF0290 protein APE_0433

Gene Names:Ordered Locus Names:APE_0433

Expression Region:1-174

Sequence Info:full length protein

View full details