Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aeromonas hydrophila subsp. hydrophila Probable intracellular septation protein A (AHA_3495)

Recombinant Aeromonas hydrophila subsp. hydrophila Probable intracellular septation protein A (AHA_3495)

SKU:CSB-CF369059AUH

Regular price $2,139.20 CAD
Regular price Sale price $2,139.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Uniprot NO.:A0KNW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIEFIPLIVFFAVYKFYDIYMATGALVVVTGLQLAYSWIRYRKVEKMQLFTFLLVGF FGGLTVFFHDDTFIKWKVTVINVLFALGLLISRYGFGKNLIKQMLGKELQAPDPVWDRVN LGWAGFFTVCGLLNLYVAFNLPQEMWVNFKVFGLLGMTLVFTLLSGVYLYRHLPAEQKNE MKK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:AHA_3495

Expression Region:1-183

Sequence Info:full length protein

View full details