Gene Bio Systems
Recombinant Aedes aegypti V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291)
Recombinant Aedes aegypti V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291)
SKU:CSB-CF002389AXQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Uniprot NO.:O16110
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALPEENPVYGPFFGVMGAAAAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV MAGIIAIYGLVVAVLIAGSLDTPTKYSLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGV RGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): V-ATPase subunit C Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:ORF Names:AAEL000291
Expression Region:1-157
Sequence Info:full length protein
