Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2(D7)

Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2(D7)

SKU:CSB-EP321587AXQ

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: P18153

Gene Names: D7

Organism: Yellowfever mosquito

AA Sequence: STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Expression Region: 18-321aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 39.1 kDa

Alternative Name(s): Protein D7 Allergen: Aed a 2

Relevance: Thought to be involved in blood-feeding.

Reference: "Isolation and characterization of the gene expressing the major salivary gland protein of the female mosquito, Aedes aegypti."James A.A., Blackmer K., Marinotti O., Ghosn C.R., Racioppi J.V.Mol. Biochem. Parasitol. 44:245-254(1991).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details