Skip to product information
1 of 1

Gene Bio Systems

Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0756 membrane protein APL_0366 (APL_0366)

Recombinant Actinobacillus pleuropneumoniae serotype 5b UPF0756 membrane protein APL_0366 (APL_0366)

SKU:CSB-CF385534AUF

Regular price $2,090.20 CAD
Regular price Sale price $2,090.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Actinobacillus pleuropneumoniae serotype 5b (strain L20)

Uniprot NO.:A3MZ84

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFLSKYLPFLDKHGLSIGIII LTIGVLSPIVSGKISLPSFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQPLLVTGLLV GTIIGVALLGGVPVGPLIAAGILSLLIGKG

Protein Names:Recommended name: UPF0756 membrane protein APL_0366

Gene Names:Ordered Locus Names:APL_0366

Expression Region:1-150

Sequence Info:full length protein

View full details