Gene Bio Systems
Recombinant Actinobacillus pleuropneumoniae serotype 3 UPF0756 membrane protein APJL_0384 (APJL_0384)
Recombinant Actinobacillus pleuropneumoniae serotype 3 UPF0756 membrane protein APJL_0384 (APJL_0384)
SKU:CSB-CF535728AXH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Uniprot NO.:B0BTB8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLQFNPISLFLVVLIFLGVVGNNNSITIAATVLLLVQQTFLSKYLPFLDKHGLSIGIII LTIGVLSPIVSGKISLPSFSEFLNWKMLLAVVAGIAVAWLGGRGVSLMGGQPLLVTGLLV GTIIGVALLGGVPVGPLIAAGILSLLIGKG
Protein Names:Recommended name: UPF0756 membrane protein APJL_0384
Gene Names:Ordered Locus Names:APJL_0384
Expression Region:1-150
Sequence Info:full length protein
