Recombinant Acidithiobacillus ferrooxidans  NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Acidithiobacillus ferrooxidans NADH-quinone oxidoreductase subunit A(nuoA)

CSB-CF480538AWI
Regular price
$1,460.00 CAD
Sale price
$1,460.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993))

Uniprot NO.:B5EN71

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNHYLPVLIFLLVALVVGVAPLLMGSSLGPHRPDSEKLSPYECGFEAFEDARMKFDVRY YLVAILFILFDLEIAFLFPWAVVFDQIGMTGFLAMMLFLAILVVGFIYEWKKGALEWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:Lferr_2257

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share