Gene Bio Systems
Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF80
Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF80
SKU:CSB-CF662416ACAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acidianus two-tailed virus (ATV)
Uniprot NO.:Q3V4W4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPAVVLFLALITSIILIILFTATIAIYHDFVTIEQNYNMTAYAQQQNTQANNVLVTGFR FLFIGLIGVTIALIIYQRRT
Protein Names:Recommended name: Putative transmembrane protein ORF80
Gene Names:
Expression Region:1-80
Sequence Info:full length protein
