Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF202(ORF202)

Recombinant Acidianus filamentous virus 2 Putative transmembrane protein ORF202(ORF202)

SKU:CSB-CF687994ADAI

Regular price $2,167.20 CAD
Regular price Sale price $2,167.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acidianus filamentous virus 2 (isolate Italy/Pozzuoli) (AFV-2)

Uniprot NO.:Q573C0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNTHYLTINLLRAIAFGLAYSILEVNVPLFHYIPVVDYRVFYLIIFAIANMTLPLSLFLG NFFLSMASEDMFYWIIKAQTPFQYAWYYPVIDGIPIADVIEVIISVFSYYYYVRHHNETT NIFHFIFVDTDNTSSSQQQQCGMWYAFTHGKAHDEYGALTLVLVSVLAILSSHSLSLTAF ATLSLIVGTGIFVDLWAHCFHH

Protein Names:Recommended name: Putative transmembrane protein ORF202

Gene Names:ORF Names:ORF202

Expression Region:1-202

Sequence Info:full length protein

View full details