Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF91a (ORF91a)

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF91a (ORF91a)

SKU:CSB-CF397675ATY

Regular price $2,003.40 CAD
Regular price Sale price $2,003.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)

Uniprot NO.:A4ZUC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALVEAVEPIIYGNTKTGISFDSITGAIIAGVVVGLAKTAFLGKFPDYVEVLIGVGLLFM YGQYDLLRGIGFVLTADGIYGLIKNYISTSS

Protein Names:Recommended name: Putative transmembrane protein ORF91a

Gene Names:ORF Names:ORF91a

Expression Region:1-91

Sequence Info:full length protein

View full details