Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acaryochloris marina UPF0391 membrane protein AM1_5042 (AM1_5042)

Recombinant Acaryochloris marina UPF0391 membrane protein AM1_5042 (AM1_5042)

SKU:CSB-CF538277AVV

Regular price $1,967.00 CAD
Regular price Sale price $1,967.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acaryochloris marina (strain MBIC 11017)

Uniprot NO.:B0C5Z6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNLTLTFLVVALIAAFLGFSGIAASAAAIAKILFCIFIVCFILVWPNKTGLVPVQEYPG RSCLHL

Protein Names:Recommended name: UPF0391 membrane protein AM1_5042

Gene Names:Ordered Locus Names:AM1_5042

Expression Region:1-66

Sequence Info:full length protein

View full details