Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R468(MIMI_R468)

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R468(MIMI_R468)

SKU:CSB-CF726013ADAZ

Regular price $2,223.20 CAD
Regular price Sale price $2,223.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acanthamoeba polyphaga mimivirus (APMV)

Uniprot NO.:Q5UQD3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEDLVCVSNHNICIHISVNILFIDIYITILMSKQESDNVFWIYDPMILFRDGNYLKIFPT KDMTQIQVLNALTRLCIYLAIIFVLVSAISGYAYVPIIFILIIIVIYFFNNNKNSVQTEM FDDNYPNTNNSDNIDNTDNIMNKQNYKKISDYNPYMNLTLNDIGSGNDDLEANLVELPKD SNRKFYTTSSTTNPNKQEDFMKWIYDLPETCKENQACCLRHEDVRFKRHNPDIDSPTPNS

Protein Names:Recommended name: Uncharacterized protein R468

Gene Names:Ordered Locus Names:MIMI_R468

Expression Region:1-240

Sequence Info:full length protein

View full details