>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Epigenetics and Nuclear Signaling
Target / Protein: ACT1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Absidia glauca (Pin mould)
Delivery time: 3-7 business days
Uniprot ID: P10982
AA Sequence: MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-140aa
Protein length: Full Length
MW: 21.2 kDa
Alternative Name(s):
Relevance: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Reference:
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.