Recombinant Yersinia pseudotuberculosis serotype O:1b  Fumarate reductase subunit C(frdC)

Recombinant Yersinia pseudotuberculosis serotype O:1b Fumarate reductase subunit C(frdC)

CSB-CF417318YAN
Regular price
$1,099.00 USD
Sale price
$1,099.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Uniprot NO.:A7FMZ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIYGVFALKSGPAGWEGF VSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKMGPEPMIKALWVVTVVA SAIILAVALL

Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein

Gene Names:Name:frdC Ordered Locus Names:YpsIP31758_3669

Expression Region:1-130

Sequence Info:full length protein