Recombinant Xenopus laevis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit A, mitochondrial(sdhd-a)

CSB-CF728129XBE

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6AZR3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LLIRPVPCLSQDLHTVQTSQIHTSQNHHAASKAASLHWTSERALSVALLGLLPAAYLYPG AAVDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKLANTSLFALSALTFAGLCYFNYHDVG ICKAVAMLWSL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit A, mitochondrial Short name= CybS-A Alternative name(s): Succinate dehydrogenase complex subunit D-A Succinate-ubiquinone oxidoreductase cytochrome b smal

Gene Names:Name:sdhd-a

Expression Region:22-152

Sequence Info:full length protein