Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q6AZR3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LLIRPVPCLSQDLHTVQTSQIHTSQNHHAASKAASLHWTSERALSVALLGLLPAAYLYPG AAVDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKLANTSLFALSALTFAGLCYFNYHDVG ICKAVAMLWSL
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit A, mitochondrial Short name= CybS-A Alternative name(s): Succinate dehydrogenase complex subunit D-A Succinate-ubiquinone oxidoreductase cytochrome b smal
Gene Names:Name:sdhd-a
Expression Region:22-152
Sequence Info:full length protein