
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Uniprot NO.:A7IGS8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVL SFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKA NAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIV STLIGSSPAQSDVEKAVDVALVKKDAA
Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2
Gene Names:Name:atpF2 Ordered Locus Names:Xaut_1977
Expression Region:1-207
Sequence Info:full length protein
You may also like
-
Recombinant Xanthobacter autotrophicus ATP synthase subunit a(atpB)
- Regular price
- $1,345.00 USD
- Sale price
- $1,345.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Syntrophus aciditrophicus ATP synthase subunit b 1(atpF1)
- Regular price
- $1,302.00 USD
- Sale price
- $1,302.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit b(atpF)
- Regular price
- $1,267.00 USD
- Sale price
- $1,267.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acinetobacter baumannii ATP synthase subunit b(atpF)
- Regular price
- $1,262.00 USD
- Sale price
- $1,262.00 USD
- Regular price
-
- Unit price
- per
Sold out