Recombinant  Uncharacterized protein ML1176 (ML1176)

Recombinant Uncharacterized protein ML1176 (ML1176)

CSB-CF346516MVN
Regular price
$1,088.00 USD
Sale price
$1,088.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:P54133

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTRPETPQAPDFDFEKSRTALLGYRIMAWTTGIWLIALCYEIVSHLVFHHEIRWIEVVHG WVYFVYVLTAFNLAIKVRWPIGKTVGVLLAGTVPLLGIIVEHFQTKDVKTRFGLRHSRT

Protein Names:Recommended name: Uncharacterized protein ML1176

Gene Names:Ordered Locus Names:ML1176 ORF Names:B1549_F2_59, MLCB1701.02c

Expression Region:1-119

Sequence Info:full length protein