
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thermosynechococcus elongatus (strain BP-1)
Uniprot NO.:Q8DJ02
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VAIPRLRDTATVFVLSGYEYFLGFLIICSLVPVLALAASALLRPKSGRMIRLTTYESGME PIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALV YAWRKRALEWS
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C
Gene Names:Name:ndhC Ordered Locus Names:tlr1429
Expression Region:2-132
Sequence Info:full length protein
You may also like
-
Recombinant Thermosynechococcus elongatus NAD(P)H-quinone oxidoreductase subunit L(ndhL)
- Regular price
- $1,514.00 USD
- Sale price
- $1,514.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus elongatus NAD(P)H-quinone oxidoreductase subunit 3(ndhC)
- Regular price
- $1,578.00 USD
- Sale price
- $1,578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3(ndhC)
- Regular price
- $1,565.00 USD
- Sale price
- $1,565.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3(ndhC)
- Regular price
- $1,581.00 USD
- Sale price
- $1,581.00 USD
- Regular price
-
- Unit price
- per
Sold out