Recombinant Synechococcus sp.  ATP synthase protein I(atpI)

Recombinant Synechococcus sp. ATP synthase protein I(atpI)

CSB-CF362427FPZ
Regular price
$1,087.00 USD
Sale price
$1,087.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Uniprot NO.:P08443

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS

Protein Names:Recommended name: ATP synthase protein I

Gene Names:Name:atpI Synonyms:atp1 Ordered Locus Names:syc1183_c

Expression Region:1-118

Sequence Info:full length protein