Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Uniprot NO.:P08443
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS
Protein Names:Recommended name: ATP synthase protein I
Gene Names:Name:atpI Synonyms:atp1 Ordered Locus Names:syc1183_c
Expression Region:1-118
Sequence Info:full length protein