Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

CSB-CF359717EGX

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P0AC45

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit

Gene Names:Name:sdhD Ordered Locus Names:c0800

Expression Region:1-115

Sequence Info:full length protein