
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Serratia proteamaculans (strain 568)
Uniprot NO.:A8G8T5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTQRKPYVRTMTPTWWQKLGFYRFYMLREGTSVPAVWFSIVLIYGVFALKGGVDSWAGF VGFLQNPLVLLINFVALLAALLHTKTWFDLAPKAANIVVNSEKMGPGPIVKTLWAVTVVA SVVILAVALV
Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein
Gene Names:Name:frdC Ordered Locus Names:Spro_0417
Expression Region:1-130
Sequence Info:full length protein
You may also like
-
Recombinant Serratia proteamaculans Fumarate reductase subunit D(frdD)
- Regular price
- $1,565.00 USD
- Sale price
- $1,565.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Fumarate reductase subunit C(frdC)
- Regular price
- $1,578.00 USD
- Sale price
- $1,578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Fumarate reductase subunit C(frdC)
- Regular price
- $1,578.00 USD
- Sale price
- $1,578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Fumarate reductase subunit C(frdC)
- Regular price
- $1,578.00 USD
- Sale price
- $1,578.00 USD
- Regular price
-
- Unit price
- per
Sold out