Recombinant Schizosaccharomyces pombe Uncharacterized protein C16E8.18 (SPAC16E8.18)

CSB-CF517565SXV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O13746

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVTSFILNATFKEFACFGNNYLIILPGIMLERNVFRHLNYSTNSICSHYQFFGGHYESF ELLVVIVYYFSHVGSFSLAEIYRITWDKRIVLYGTTTTLVYCSEGSD

Protein Names:Recommended name: Uncharacterized protein C16E8.18

Gene Names:ORF Names:SPAC16E8.18

Expression Region:1-107

Sequence Info:full length protein