Recombinant Schizosaccharomyces pombe  Putative uncharacterized transmembrane protein C32F12.17 (SPBC32F12.17)

Recombinant Schizosaccharomyces pombe Putative uncharacterized transmembrane protein C32F12.17 (SPBC32F12.17)

CSB-CF522302SXV
Regular price
$1,089.00 USD
Sale price
$1,089.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLHFASDGLFLLFFLIIFFFSFLSIFFFSTYSLTHPHTYLLLPTYPLPIAFTSLKPRSL NTIQINVLAFLTLACFFSLSFSVSRSIPFYSYSISYLDSAPSNTFFINSR

Protein Names:Recommended name: Putative uncharacterized transmembrane protein C32F12.17

Gene Names:ORF Names:SPBC32F12.17

Expression Region:1-110

Sequence Info:full length protein