Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P38317
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLLNTLSNFGGTWPRLIIMSMINYFTVYQCTIPGTNKVYVTHGGSMQACTELLNGTVTI LRDGYYITNLICIVVGLFLYFGYLKRKILHLQSLPISSWRFFHFFFTILAVTSRAIYYKS QNWRREC
Protein Names:Recommended name: Uncharacterized protein YBR219C
Gene Names:Ordered Locus Names:YBR219C ORF Names:YBR1509
Expression Region:1-127
Sequence Info:full length protein