
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:O13543
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMLRKPKKVIELFIASSLSKKKQTEPQAEQDHYFWLSSSHLFIFESSTIKKKQNTLRTLC NQPHKMQNLFFKQKIQLYIDTSLSFLLLLFFYFNNYYFLSMTYASLVNK
Protein Names:Recommended name: Putative uncharacterized protein YLR294C
Gene Names:Ordered Locus Names:YLR294C ORF Names:L8003.19A
Expression Region:1-109
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR198C (YLR198C)
- Regular price
- $1,566.00 USD
- Sale price
- $1,566.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR302C (YLR302C)
- Regular price
- $1,567.00 USD
- Sale price
- $1,567.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL059C(YLL059C)
- Regular price
- $1,621.00 USD
- Sale price
- $1,621.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR038C (YJR038C)
- Regular price
- $1,567.00 USD
- Sale price
- $1,567.00 USD
- Regular price
-
- Unit price
- per
Sold out