Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR294C (YLR294C)

CSB-CF517089SVG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:O13543

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMLRKPKKVIELFIASSLSKKKQTEPQAEQDHYFWLSSSHLFIFESSTIKKKQNTLRTLC NQPHKMQNLFFKQKIQLYIDTSLSFLLLLFFYFNNYYFLSMTYASLVNK

Protein Names:Recommended name: Putative uncharacterized protein YLR294C

Gene Names:Ordered Locus Names:YLR294C ORF Names:L8003.19A

Expression Region:1-109

Sequence Info:full length protein