
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P40587
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVSYIEEALGVYFTEVEKQWKLFNTEKSWS PVGLEDAKLPKEAYRFKLTWILKRIFKLRCLQVFLYYFLIVYTSGNVDLISRFLFPVVMF FIMTRDFQNMGMIVLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWNNE EFFYDGLDCEWFFSCFFYRLLSLKKTMWFASLNVELWPYVKEAQSVVTSL
Protein Names:Recommended name: Putative uncharacterized protein YIR043C
Gene Names:Ordered Locus Names:YIR043C ORF Names:YI8224.05C
Expression Region:1-230
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YAL042C-A (YAL042C-A)
- Regular price
- $1,247.00 USD
- Sale price
- $1,247.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Uncharacterized protein YEL045C (YEL045C)
- Regular price
- $1,261.00 USD
- Sale price
- $1,261.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL041C (YGL041C)
- Regular price
- $1,228.00 USD
- Sale price
- $1,228.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YIR014W (YIR014W)
- Regular price
- $1,351.00 USD
- Sale price
- $1,351.00 USD
- Regular price
-
- Unit price
- per
Sold out