
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P32858
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIP ALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI
Protein Names:Recommended name: Altered inheritance of mitochondria protein 26, mitochondrial
Gene Names:Name:AIM26 Ordered Locus Names:YKL037W ORF Names:YKL250
Expression Region:1-118
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 19, mitochondrial(AIM19)
- Regular price
- $1,284.00 USD
- Sale price
- $1,284.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
- Regular price
- $1,286.00 USD
- Sale price
- $1,286.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)
- Regular price
- $1,271.00 USD
- Sale price
- $1,271.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 5, mitochondrial(AIM5)
- Regular price
- $1,238.00 USD
- Sale price
- $1,238.00 USD
- Regular price
-
- Unit price
- per
Sold out